PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa03598s010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HB-other
Protein Properties Length: 208aa    MW: 23874.9 Da    PI: 6.1734
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa03598s010.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox49.95.6e-161391856
                    HHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox 18 lFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                    +F+++++p++++r eL+k+l L++rqVk+WFqNrR+++k
  Csa03598s010.1  1 MFKECPHPDEKQRLELSKRLCLETRQVKFWFQNRRTQMK 39
                    69**********************************999 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.1E-15148IPR009057Homeodomain-like
PROSITE profilePS5007114.511141IPR001356Homeobox domain
PfamPF000462.0E-13139IPR001356Homeobox domain
SMARTSM003890.0021145IPR001356Homeobox domain
SuperFamilySSF466893.55E-13145IPR009057Homeodomain-like
CDDcd000862.64E-12241No hitNo description
PROSITE patternPS0002701639IPR017970Homeobox, conserved site
PROSITE profilePS5084812.621163208IPR002913START domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MFKECPHPDE KQRLELSKRL CLETRQVKFW FQNRRTQMKT QLERHENALL RQENDKLRAE  60
NMSIREAMRN PICTNCGGPA MLGDVSLEEH HLRIENARLK DELDRVCNLT GKFLGHHHHH  120
YNSSLELAVG TNNGGNFAFP PDFGGGACLP PPQQQQQQTG INGIDQKSVL LELALNAMDE  180
LVKLAHSEEP LWVKSLDGER DELNQDEY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2269680.0AK226968.1 Arabidopsis thaliana mRNA for homeodomain protein AHDP, complete cds, clone: RAFL09-36-B10.
GenBankATU852540.0U85254.1 Arabidopsis thaliana homeodomain protein AHDP mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010419627.11e-150PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like
RefseqXP_010419628.11e-150PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like
RefseqXP_010456250.11e-150PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like
SwissprotQ0WV121e-128ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLR0H8W01e-140R0H8W0_9BRAS; Uncharacterized protein
STRINGAT4G00730.11e-126(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17003611
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.21e-125HD-ZIP family protein